عضوية متميزة للموردين رفيعي المستوى.

المنتجات التي نقدمها هي لأبحاث المختبر أو الإنتاج فقط ، ممنوع للاستهلاك الخاص مباشرة.

الصفحة الرئيسية
المنتجات
حول بنا
جولة في المعمل
ضبط الجودة
اتصل بنا
طلب اقتباس
منزل المنتجاتبحوث هرمون الببتيد

FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة

شهادة
نوعية جيدة الببتيد واجهات برمجة التطبيقات للمبيعات
نوعية جيدة الببتيد واجهات برمجة التطبيقات للمبيعات
سعر جيد. المنتج هو حد بعيد ، سعيد جدا وسعيد ، فيل شراء مرة أخرى.

—— K ****** s United Kingdom

نقاء عالية ، والشحن السريع ، أوصت هذه الشركة.

—— Perry ***** t United States

خدمة رائعة تم إخباري عن طلبي طوال الوقت.

—— E **** y أستراليا

ابن دردش الآن

FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة

الصين FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة المزود
FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة المزود FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة المزود FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة المزود

صورة كبيرة :  FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة

تفاصيل المنتج:

مكان المنشأ: الصين
اسم العلامة التجارية: MOBELBIO
إصدار الشهادات: ISO,SGS

شروط الدفع والشحن:

الحد الأدنى لكمية: 10mg
الأسعار: According to order amounts
تفاصيل التغليف: قارورة أو زجاجة
وقت التسليم: في غضون 3-5 أيام
شروط الدفع: T/T
القدرة على العرض: 1 غرام / يوم
Contact Now
مفصلة وصف المنتج
نقاء: 97٪ دقيقة مظهر: مسحوق أبيض

  • اسم المنتج: FOXO4 D-Retro-Inverso (DRI) الببتيد
  • تسلسل
    H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
  • ثلاثة حروف
    HD-لوي-D-منتدى المجالس الرومانسية-D-لوي-D-الارجنتين-D-ليز-D-غلو-D-برو-D-علاء-D-سر-D-غلو-D-إيل-D-علاء-D- GLN-D-سر-D-إيل-D-لوي-D-غلو-D-علاء-D-صور-D-سر-D-GLN-D-الأسباراجين-D-الغليسين-D-التربتوفان-D-Ala- D-الأسباراجين-D-الارجنتين-D-الارجنتين-D-سر-D-الغليسين-D-الغليسين-D-ليز-D-الارجنتين-D-برو-D-برو-D-برو-D-الارجنتين-D- الارجنتين-D-الارجنتين-D-GLN-D-الارجنتين-D-الارجنتين-D-ليز-D-ليز-D-الارجنتين-D-الغليسين-OH
  • الطول (aa): 46
  • النقاوة الببتيد (HPLC): 97 ٪ دقيقة
  • الصيغة الجزيئية: C 228 H 388 N 86 O 64
  • الوزن الجزيئي: 5358.05
  • المصدر: Synthetic
  • الجودة: راجع COA و MS و HPLC و MSDS
  • أوصاف FOXO4 DRI
  • تم الإبلاغ عن الببتيد FOXO4 D-Retro-Inverso ، والمعروف أيضًا باسم FOXO4 DRI peptide لأول مرة في " الاستموات المبرمج للخلايا المتآكلة يستعيد توازن الأنسجة استجابةً للسمية الكيماوية والشيخوخة" بواسطة Baar et al. يحتوي ببتيد FOXO4 DRI على تسلسل الأحماض الأمينية: LTLRKEPASEIAQSILEAYSQNGWANRRSGGRR ، حيث الأحماض الأمينية في تسلسل الحمض الأميني المذكور هي بقايا حمض أميني D. FOXO4 D-Retro-Inverso يستخدم الببتيد بشكل انتقائي في موت الخلايا المبرمج للخلايا المسننة في عكس تأثيرات السمية الكيماوية والشيخوخة في الفئران.
  • إرشادات التخزين
    من الناحية المثالية ينبغي تخزين الببتيد FOXO4 D-Retro-Inverso (DRI) في الفريزر عند أو أسفل -9 درجة مئوية. يجب تبريد البراد FOXO4 D-Retro-Inverso (DRI) بعد إعادة التكوين .
  • ملاحظات: المنتجات مقيدة في المختبر ، ممنوعة للاستهلاك الخاص مباشرة.

تفاصيل الاتصال
HANGZHOU MOBEL BIOTECHNOLOGY CO.,LTD

اتصل شخص: admin

إرسال استفسارك مباشرة لنا (0 / 3000)