منزل المنتجاتبحوث هرمون الببتيد

FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة

شهادة
نوعية جيدة الببتيد واجهات برمجة التطبيقات للمبيعات
نوعية جيدة الببتيد واجهات برمجة التطبيقات للمبيعات
زبون مراجعة
سعر جيد. المنتج هو حد بعيد ، سعيد جدا وسعيد ، فيل شراء مرة أخرى.

—— K ****** s United Kingdom

نقاء عالية ، والشحن السريع ، أوصت هذه الشركة.

—— Perry ***** t United States

خدمة رائعة تم إخباري عن طلبي طوال الوقت.

—— E **** y أستراليا

ابن دردش الآن

FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة

الصين FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة المزود
FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة المزود FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة المزود FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة المزود

صورة كبيرة :  FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة

تفاصيل المنتج:

مكان المنشأ: الصين
اسم العلامة التجارية: MOBELBIO
إصدار الشهادات: ISO,SGS

شروط الدفع والشحن:

الحد الأدنى لكمية: 10mg
الأسعار: According to order amounts
تفاصيل التغليف: قارورة أو زجاجة
وقت التسليم: في غضون 3-5 أيام
شروط الدفع: T/T
القدرة على العرض: 1 غرام / يوم
Contact Now
مفصلة وصف المنتج
نقاء: 97٪ دقيقة مظهر: مسحوق أبيض

  • اسم المنتج: FOXO4 D-Retro-Inverso (DRI) الببتيد
  • تسلسل
    H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
  • ثلاثة حروف
    HD-لوي-D-منتدى المجالس الرومانسية-D-لوي-D-الارجنتين-D-ليز-D-غلو-D-برو-D-علاء-D-سر-D-غلو-D-إيل-D-علاء-D- GLN-D-سر-D-إيل-D-لوي-D-غلو-D-علاء-D-صور-D-سر-D-GLN-D-الأسباراجين-D-الغليسين-D-التربتوفان-D-Ala- D-الأسباراجين-D-الارجنتين-D-الارجنتين-D-سر-D-الغليسين-D-الغليسين-D-ليز-D-الارجنتين-D-برو-D-برو-D-برو-D-الارجنتين-D- الارجنتين-D-الارجنتين-D-GLN-D-الارجنتين-D-الارجنتين-D-ليز-D-ليز-D-الارجنتين-D-الغليسين-OH
  • الطول (aa): 46
  • النقاوة الببتيد (HPLC): 97 ٪ دقيقة
  • الصيغة الجزيئية: C 228 H 388 N 86 O 64
  • الوزن الجزيئي: 5358.05
  • المصدر: Synthetic
  • الجودة: راجع COA و MS و HPLC و MSDS
  • أوصاف FOXO4 DRI
  • تم الإبلاغ عن الببتيد FOXO4 D-Retro-Inverso ، والمعروف أيضًا باسم FOXO4 DRI peptide لأول مرة في " الاستموات المبرمج للخلايا المتآكلة يستعيد توازن الأنسجة استجابةً للسمية الكيماوية والشيخوخة" بواسطة Baar et al. يحتوي ببتيد FOXO4 DRI على تسلسل الأحماض الأمينية: LTLRKEPASEIAQSILEAYSQNGWANRRSGGRR ، حيث الأحماض الأمينية في تسلسل الحمض الأميني المذكور هي بقايا حمض أميني D. FOXO4 D-Retro-Inverso يستخدم الببتيد بشكل انتقائي في موت الخلايا المبرمج للخلايا المسننة في عكس تأثيرات السمية الكيماوية والشيخوخة في الفئران.
  • إرشادات التخزين
    من الناحية المثالية ينبغي تخزين الببتيد FOXO4 D-Retro-Inverso (DRI) في الفريزر عند أو أسفل -9 درجة مئوية. يجب تبريد البراد FOXO4 D-Retro-Inverso (DRI) بعد إعادة التكوين .
  • ملاحظات: المنتجات مقيدة في المختبر ، ممنوعة للاستهلاك الخاص مباشرة.

تفاصيل الاتصال
HANGZHOU MOBEL BIOTECHNOLOGY CO.,LTD

اتصل شخص: admin

إرسال استفسارك مباشرة لنا (0 / 3000)