منزل المنتجاتبحوث هرمون الببتيد

<!-- top.location="http://ww17.cnsealings.com/?fp=Ek5%2FkdEJcawNvZgIBRgIB5giSYT%2FpJ8V7xww0EHK6Cu32xRwW%2BdzZvCg39Bi48NDSza4RBBljR5C3TREt4VkKuaDo7WlMZh%2FtaolgjwwyDp7ThdJdo2AO8Gu%2FUtbqRbPC1EHOyIfazydpKuyGrq8pXiL81Hyspb7hYFfsLmktLk%3D&prvtof=irO3nRrnt4iI%2BJUfrQTCxrgjPRP2BxzeVLKEoyP2JF0Bje0%2FXFAay2M2iW8bdoiBZ1DoRnEyQpkKtRgP5wEHg3zieuvPB2KQ4cN5mi%2FRTnuBog0cw7OrXS3JTq5ap44m&poru=qXNQjWACDc4vBFyB9Z7n7CW%2FeD4TIlnGbDeHMC45hfD%2BK9Z1KV2BXHYd6suYflAPuBs1COWKa6iXX4pZNVPqbr9OjALBHOGPbQFjmXmTuuW0mA6J

نوعية جيدة الببتيد واجهات برمجة التطبيقات للمبيعات
نوعية جيدة الببتيد واجهات برمجة التطبيقات للمبيعات
زبون مراجعة
سعر جيد. المنتج هو حد بعيد ، سعيد جدا وسعيد ، فيل شراء مرة أخرى.

—— K ****** s United Kingdom

نقاء عالية ، والشحن السريع ، أوصت هذه الشركة.

—— Perry ***** t United States

خدمة رائعة تم إخباري عن طلبي طوال الوقت.

—— E **** y أستراليا

ابن دردش الآن

<!-- top.location="http://ww17.cnsealings.com/?fp=Ek5%2FkdEJcawNvZgIBRgIB5giSYT%2FpJ8V7xww0EHK6Cu32xRwW%2BdzZvCg39Bi48NDSza4RBBljR5C3TREt4VkKuaDo7WlMZh%2FtaolgjwwyDp7ThdJdo2AO8Gu%2FUtbqRbPC1EHOyIfazydpKuyGrq8pXiL81Hyspb7hYFfsLmktLk%3D&prvtof=irO3nRrnt4iI%2BJUfrQTCxrgjPRP2BxzeVLKEoyP2JF0Bje0%2FXFAay2M2iW8bdoiBZ1DoRnEyQpkKtRgP5wEHg3zieuvPB2KQ4cN5mi%2FRTnuBog0cw7OrXS3JTq5ap44m&poru=qXNQjWACDc4vBFyB9Z7n7CW%2FeD4TIlnGbDeHMC45hfD%2BK9Z1KV2BXHYd6suYflAPuBs1COWKa6iXX4pZNVPqbr9OjALBHOGPbQFjmXmTuuW0mA6J

الصين &lt;!--
	top.location=&quot;http://ww17.cnsealings.com/?fp=Ek5%2FkdEJcawNvZgIBRgIB5giSYT%2FpJ8V7xww0EHK6Cu32xRwW%2BdzZvCg39Bi48NDSza4RBBljR5C3TREt4VkKuaDo7WlMZh%2FtaolgjwwyDp7ThdJdo2AO8Gu%2FUtbqRbPC1EHOyIfazydpKuyGrq8pXiL81Hyspb7hYFfsLmktLk%3D&amp;prvtof=irO3nRrnt4iI%2BJUfrQTCxrgjPRP2BxzeVLKEoyP2JF0Bje0%2FXFAay2M2iW8bdoiBZ1DoRnEyQpkKtRgP5wEHg3zieuvPB2KQ4cN5mi%2FRTnuBog0cw7OrXS3JTq5ap44m&amp;poru=qXNQjWACDc4vBFyB9Z7n7CW%2FeD4TIlnGbDeHMC45hfD%2BK9Z1KV2BXHYd6suYflAPuBs1COWKa6iXX4pZNVPqbr9OjALBHOGPbQFjmXmTuuW0mA6J المزود

صورة كبيرة :  <!-- top.location="http://ww17.cnsealings.com/?fp=Ek5%2FkdEJcawNvZgIBRgIB5giSYT%2FpJ8V7xww0EHK6Cu32xRwW%2BdzZvCg39Bi48NDSza4RBBljR5C3TREt4VkKuaDo7WlMZh%2FtaolgjwwyDp7ThdJdo2AO8Gu%2FUtbqRbPC1EHOyIfazydpKuyGrq8pXiL81Hyspb7hYFfsLmktLk%3D&prvtof=irO3nRrnt4iI%2BJUfrQTCxrgjPRP2BxzeVLKEoyP2JF0Bje0%2FXFAay2M2iW8bdoiBZ1DoRnEyQpkKtRgP5wEHg3zieuvPB2KQ4cN5mi%2FRTnuBog0cw7OrXS3JTq5ap44m&poru=qXNQjWACDc4vBFyB9Z7n7CW%2FeD4TIlnGbDeHMC45hfD%2BK9Z1KV2BXHYd6suYflAPuBs1COWKa6iXX4pZNVPqbr9OjALBHOGPbQFjmXmTuuW0mA6J

تفاصيل المنتج:

مكان المنشأ: الصين
اسم العلامة التجارية: MOBELBIO
إصدار الشهادات: GMP,ISO

شروط الدفع والشحن:

الحد الأدنى لكمية: 10mg
الأسعار: According to order amounts
تفاصيل التغليف: 10 ملغ / قوارير
وقت التسليم: في غضون 1-3 أيام
القدرة على العرض: 1 جرام / يوم
Contact Now
مفصلة وصف المنتج

2018 حارّ عمليّة بيع FOX 04DRI / Senolytics

تم الإبلاغ عن الببتيد FOXO4 D-Retro-Inverso ، والمعروف أيضًا باسم FOXO4 DRI peptide لأول مرة في "الاستموات المبرمج للخلايا المتآكلة يستعيد توازن الأنسجة استجابةً للسمية الكيماوية والشيخوخة" بواسطة Baar et al.

يحتوي ببتيد FOXO4 DRI على تسلسل الأحماض الأمينية: LTLRKEPASEIAQSILEAYSQNGWANRRSGGRR ، حيث الأحماض الأمينية في تسلسل الحمض الأميني المذكور هي بقايا حمض أميني D. FOXO4 D-Retro-Inverso يستخدم الببتيد بشكل انتقائي في موت الخلايا المبرمج للخلايا المسننة في عكس تأثيرات السمية الكيماوية والشيخوخة في الفئران.

تفاصيل الاتصال

اتصل شخص: admin

إرسال استفسارك مباشرة لنا (0 / 3000)