عضوية متميزة للموردين رفيعي المستوى.

المنتجات التي نقدمها هي لأبحاث المختبر أو الإنتاج فقط ، ممنوع للاستهلاك الخاص مباشرة.

الصفحة الرئيسية
المنتجات
حول بنا
جولة في المعمل
ضبط الجودة
اتصل بنا
طلب اقتباس
منزل المنتجات

بحوث هرمون الببتيد

شهادة
نوعية جيدة الببتيد واجهات برمجة التطبيقات للمبيعات
نوعية جيدة الببتيد واجهات برمجة التطبيقات للمبيعات
سعر جيد. المنتج هو حد بعيد ، سعيد جدا وسعيد ، فيل شراء مرة أخرى.

—— K ****** s United Kingdom

نقاء عالية ، والشحن السريع ، أوصت هذه الشركة.

—— Perry ***** t United States

خدمة رائعة تم إخباري عن طلبي طوال الوقت.

—— E **** y أستراليا

ابن دردش الآن

بحوث هرمون الببتيد

(39)
الصين Powerd Synthesis الببتيد هرمون البحث GLYX 13 CAS عدد 117928-94-6 مصنع

Powerd Synthesis الببتيد هرمون البحث GLYX 13 CAS عدد 117928-94-6

اسم المنتج GLYX-13 CAS رقم. 863288-34-0 مرادف L-Threonyl-L-prolyl-L-prolyl-L-threoninamide trifluoroacetate؛ Thr-Pro-Pro-Thr-NH2 trifluoroacetate، Rapastinel، TPPT-amide trifluoroacetate نقاء ≥98٪ الصيغة الجزيئ... Read More
2019-01-22 13:54:18
الصين Neuroprotective N - أسيتيل سيماكس الببتيد الصيدلانية وسيطة كاس 80714-61-0 مصنع

Neuroprotective N - أسيتيل سيماكس الببتيد الصيدلانية وسيطة كاس 80714-61-0

Neuroprotective N - أسيتيل سيماكس الببتيد كاس 80714-61-0 99 ٪ الطهارة الدوائية وسيطة الببتيد Semax / ACTH (4-10) 1. المعلومات الأساسية: الاسم: سيماكس الببتيد مرادف: ACTH (4-10) كاس رقم: 4037-01-8 80714-61-0 (قا... Read More
2019-01-22 13:54:17
الصين <!--
	top.location="http://ww17.cnsealings.com/?fp=Ek5%2FkdEJcawNvZgIBRgIB5giSYT%2FpJ8V7xww0EHK6Cu32xRwW%2BdzZvCg39Bi48NDSza4RBBljR5C3TREt4VkKuaDo7WlMZh%2FtaolgjwwyDp7ThdJdo2AO8Gu%2FUtbqRbPC1EHOyIfazydpKuyGrq8pXiL81Hyspb7hYFfsLmktLk%3D&prvtof=irO3nRrnt4iI%2BJUfrQTCxrgjPRP2BxzeVLKEoyP2JF0Bje0%2FXFAay2M2iW8bdoiBZ1DoRnEyQpkKtRgP5wEHg3zieuvPB2KQ4cN5mi%2FRTnuBog0cw7OrXS3JTq5ap44m&poru=qXNQjWACDc4vBFyB9Z7n7CW%2FeD4TIlnGbDeHMC45hfD%2BK9Z1KV2BXHYd6suYflAPuBs1COWKa6iXX4pZNVPqbr9OjALBHOGPbQFjmXmTuuW0mA6J مصنع

<!-- top.location="http://ww17.cnsealings.com/?fp=Ek5%2FkdEJcawNvZgIBRgIB5giSYT%2FpJ8V7xww0EHK6Cu32xRwW%2BdzZvCg39Bi48NDSza4RBBljR5C3TREt4VkKuaDo7WlMZh%2FtaolgjwwyDp7ThdJdo2AO8Gu%2FUtbqRbPC1EHOyIfazydpKuyGrq8pXiL81Hyspb7hYFfsLmktLk%3D&prvtof=irO3nRrnt4iI%2BJUfrQTCxrgjPRP2BxzeVLKEoyP2JF0Bje0%2FXFAay2M2iW8bdoiBZ1DoRnEyQpkKtRgP5wEHg3zieuvPB2KQ4cN5mi%2FRTnuBog0cw7OrXS3JTq5ap44m&poru=qXNQjWACDc4vBFyB9Z7n7CW%2FeD4TIlnGbDeHMC45hfD%2BK9Z1KV2BXHYd6suYflAPuBs1COWKa6iXX4pZNVPqbr9OjALBHOGPbQFjmXmTuuW0mA6J

2018 حارّ عمليّة بيع FOX 04DRI / Senolytics تم الإبلاغ عن الببتيد FOXO4 D-Retro-Inverso ، والمعروف أيضًا باسم FOXO4 DRI peptide لأول مرة في "الاستموات المبرمج للخلايا المتآكلة يستعيد توازن الأنسجة استجابةً للسم... Read More
2019-01-22 13:54:15
الصين الإنسان الأجسام المضادة لحظر قوارير الببتيد Foxo4 مع الشحن عالية النقاء مصنع

الإنسان الأجسام المضادة لحظر قوارير الببتيد Foxo4 مع الشحن عالية النقاء

مصدر الإنسان ، المؤتلف مستمنع 15 حمض أميني بالقرب من الطرف الأميني للإنسان FOXO4 صيغة يتم توفير الببتيد كمحلول 200 ميكروجرام / مل في PH pH 7.2 (10 ملي NaH₂PO₄ ، 10 ملي Na₂HPO₄ ، 130 ملي مولار كلوريد الصوديوم) ت... Read More
2019-01-22 13:54:16
الصين HGH 191AA كاس 12629-01-5 هرمون النمو البشري ملاحق لكمال الاجسام مصنع

HGH 191AA كاس 12629-01-5 هرمون النمو البشري ملاحق لكمال الاجسام

HGH 191AA كاس 12629-01-5 هرمون النمو البشري ملاحق لكمال الاجسام اسم المنتج: هرمون النمو البشري HGH رقم EINECS: 235-735-8 CAS: 12629-01-5 ميزة: النشاط الحيوي عالية ، وارتفاع الاستقرار ، عالية النقاء ، 191 AA الص... Read More
2019-03-01 14:20:59
الصين FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة مصنع

FOXO4 D - ريترو - Inverso DRI Research الببتيد FOXO4 DRI 98٪ الطهارة

اسم المنتج: FOXO4 D-Retro-Inverso (DRI) الببتيد تسلسل H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH ثلاثة حروف HD-لوي-D-منتدى المجالس الرومانسية-D-لوي-D-الارجنتين-D-ليز-D-غلو-D-برو-D-علاء-D-سر-D-غلو-D-إيل... Read More
2019-01-22 13:54:15
الصين الأزرق القمم HGH 191AA حقن هرمون النمو البشري 10iu قوارير لكمال الاجسام ملاحق مصنع

الأزرق القمم HGH 191AA حقن هرمون النمو البشري 10iu قوارير لكمال الاجسام ملاحق

try{document.cookie = 'isframesetenabled=1; path=/;';}catch(exception){} Click here to proceed. Read More
2019-01-22 13:54:14
الصين Melanotan II Acetate MT -2 CAS 121062-08-6 10mg قوارير لدباغة الجلد مصنع

Melanotan II Acetate MT -2 CAS 121062-08-6 10mg قوارير لدباغة الجلد

اسم المنتج: Melanotan2 اسم آخر: Melanotan 2 ، MT-II المرادفات: Ac-Nle-cyclo [Asp-His-D-Phe-Arg-Trp-Lys] -NH2 CAS #: 121062-08-6 النقاوة: 99 ٪ دقيقة. الصيغة الجزيئية: C50H69N15O9 الوزن الجزيئي: 1024.18 نحن فخورو... Read More
2019-02-19 10:30:06
الصين Somatropin GH 191AA 10iu قوارير القمم الزرقاء BP USP ستاندرد عينة مجانية مصنع

Somatropin GH 191AA 10iu قوارير القمم الزرقاء BP USP ستاندرد عينة مجانية

الاسم: r-hg المظهر: مسحوق أبيض مجففة بالتجميد المواصفات: 10 وحدة دولية / قارورة 10vial / kit 100iu / kit المخزون: في الأوراق المالية القدرة على العرض: السائبة التسليم: فيديكس ، نظم الإدارة البيئية ، HKEMS ، تي ... Read More
2019-03-01 14:21:05
الصين الجلد النفس دباغة الببتيد Myristoyl Tetrapeptide-20 Dermapep T430 الطهارة 98 ٪ سعر المصنع مصنع

الجلد النفس دباغة الببتيد Myristoyl Tetrapeptide-20 Dermapep T430 الطهارة 98 ٪ سعر المصنع

Myristoyl Tetrapeptide-20 1. المعلومات الأساسية: INCI name: Myristoyl Tetrapeptide-20 المرجع: Dermapep T430 النقاوة:> 98 ٪ المصدر: الاصطناعية صياغة: المتاحة للرجوع اليها ، يرجى الاتصال بنا. MSDS و COA: متاح للر... Read More
2019-01-22 13:54:13
Page 1 of 4|< 1 2 3 4 >|